Overview

  • Product name
  • Description
    Rabbit polyclonal to CD3 zeta
  • Host species
    Rabbit
  • Specificity
    ab190728 detects endogenous levels of CD3 zeta protein.
  • Tested applications
    Suitable for: WB, IHC-P, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD3 zeta aa 1-164.
    Sequence:

    MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALF LRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR


    Database link: P20963

  • Positive control
    • Extracts of Jurkat cell line.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab190728 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen, and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 19 kDa.
IHC-P 1/50 - 1/200.
IHC-Fr 1/50 - 1/200.

Target

  • Function
    Probable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
  • Involvement in disease
    Defects in CD247 are the cause of immunodeficiency due to defect in CD3-zeta (CD3ZID) [MIM:610163]. An immunological deficiency characterized by T-cells impaired immune response to alloantigens, tetanus toxoid and mitogens.
  • Sequence similarities
    Belongs to the CD3Z/FCER1G family.
    Contains 3 ITAM domains.
  • Domain
    The ITAM domains mediate interaction with SHB.
  • Post-translational
    modifications
    Phosphorylated on Tyr residues after T-cell receptor triggering.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4930549J05Rik antibody
    • A430104F18Rik antibody
    • AW552088 antibody
    • CD247 antibody
    • CD247 antigen antibody
    • Cd247 molecule antibody
    • Cd3 antibody
    • CD3 antigen, zeta polypeptide, isoform CRA_b antibody
    • CD3 antigen, zeta subunit antibody
    • CD3-eta antibody
    • CD3H antibody
    • CD3Q antibody
    • Cd3z antibody
    • CD3Z antigen zeta polypeptide (TiT3 complex) antibody
    • CD3Z_HUMAN antibody
    • CD3zeta antibody
    • CD3zeta chain antibody
    • MGC140430 antibody
    • T cell receptor T3 zeta chain antibody
    • T cell surface glycoprotein CD3 zeta chain antibody
    • T-cell antigen receptor complex, zeta subunit of CD3 antibody
    • T-cell receptor T3 zeta chain antibody
    • T-cell surface glycoprotein CD3 zeta chain antibody
    • T3z antibody
    • TCR zeta chain antibody
    • TCRk antibody
    • TCRZ antibody
    • TCRzeta antibody
    see all

Images

  • Anti-CD3 zeta antibody (ab190728) + extracts of Jurkat cell line

    Predicted band size: 19 kDa

References

ab190728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up