Overview

  • Product name
  • Description
    Rabbit polyclonal to CD3D
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Full length protein corresponding to Human CD3D aa 1-171.
    Sequence:

    MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGT LLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD PATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQ PLRDRDDAQYSHLGGNWARNK


    Database link: P04234

  • Positive control
    • Mouse kidney tissue lysate, CD3D transfected 293T cell line lysate, HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab103573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 19 kDa.
ICC/IF 1/1200.

Target

  • Function
    The CD3 complex mediates signal transduction.
  • Involvement in disease
    Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities
    Contains 1 ITAM domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Form
    .
  • Alternative names
    • CD3 antigen delta subunit antibody
    • CD3 delta antibody
    • CD3-delta antibody
    • CD3d antibody
    • CD3d antigen delta polypeptide (TiT3 complex) antibody
    • CD3d molecule antibody
    • CD3d molecule delta (CD3-TCR complex) antibody
    • CD3D_HUMAN antibody
    • IMD19 antibody
    • OKT3 delta chain antibody
    • T cell receptor T3 delta chain antibody
    • T-cell receptor T3 delta chain antibody
    • T-cell surface glycoprotein CD3 delta chain antibody
    • T3D antibody
    see all

Images

  • Anti-CD3D antibody (ab103573) at 1/500 dilution + Mouse Kidney tissue lysate at 50 µg

    Predicted band size : 19 kDa
  • All lanes : Anti-CD3D antibody (ab103573) at 1/500 dilution

    Lane 1 : CD20 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 25 µg per lane.


    Predicted band size : 19 kDa
  • Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX.
    ab103573 at 1/1200 staining CDED in HeLa cells with anti-CANX mouse monoclonal antibody 1/50. Signals were detected by Duolink® 30 Detection Kit 613(red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.

References

ab103573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up