Overview

  • Product name
  • Description
    Rabbit polyclonal to CD47
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Other Immunogen Type corresponding to Human CD47 aa 20-140.
    Sequence:

    LLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFD GALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTEL TREGETIIELKYRVVSWFSPN


    Database link: Q08722

  • Positive control
    • WB: MCF-7 and SK-OV-3 cell lysates; Mouse lung lysate. ICC/IFF: MCF-7 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Function
    Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
  • Tissue specificity
    Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Antigen identified by monoclonal antibody 1D8 antibody
    • Antigenic surface determinant protein OA3 antibody
    • CD 47 antibody
    • CD47 antibody
    • CD47 antigen (Rh-related antigen, integrin-associated signal transducer) antibody
    • CD47 antigen antibody
    • CD47 glycoprotein antibody
    • CD47 molecule antibody
    • CD47_HUMAN antibody
    • IAP antibody
    • Integrin Associated Protein antibody
    • Integrin associated signal transducer antibody
    • Integrin-associated protein antibody
    • Leukocyte surface antigen CD47 antibody
    • MER 6 antibody
    • MER6 antibody
    • OA 3 antibody
    • OA3 antibody
    • OTTHUMP00000041152 antibody
    • OTTHUMP00000041153 antibody
    • Protein MER6 antibody
    • Rh related antigen antibody
    • Surface antigen identified by monoclonal antibody 1D8 antibody
    see all

Images

  • All lanes : Anti-CD47 antibody (ab175388) at 1/1000 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 2 : SK-OV-3 (human ovary adenocarcinoma cell line) cell lysate
    Lane 3 : Mouse lung lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 35 kDa



    Blocking buffer: 3% nonfat dry milk in TBST.

    Exposure time: 90 seconds.

     

  • MCF-7 (human breast adenocarcinoma cell line) cells satined for CD47 (green) using ab175388 in ICC/IF.

    DAPI nuclear staining in blue.

References

ab175388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Flow Cytometry
Sample
Human Cell (MDA-MB-231 breast cancer cell line)
Permeabilization
No
Specification
MDA-MB-231 breast cancer cell line
Username

Abcam user community

Verified customer

Submitted Dec 21 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Chicken Tissue sections (Liver)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH6.0
Permeabilization
No
Specification
Liver
Blocking step
BSA + Milk + Serum as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 27°C
Fixative
Formaldehyde
Username

Dr. Marcelo Pelajo Machado

Verified customer

Submitted May 18 2017

Abreviews
Application
Western blot
Sample
Mouse Cell lysate - whole cell (Heart tissue (mouse))
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
40 µg
Specification
Heart tissue (mouse)
Blocking step
Seablock as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 26°C
Username

Abcam user community

Verified customer

Submitted Jul 29 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up