Anti-CD69 antibody (ab175391)
Key features and details
- Rabbit polyclonal to CD69
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-CD69 antibody
See all CD69 primary antibodies -
Description
Rabbit polyclonal to CD69 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human CD69 aa 1-199.
Sequence:MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVF ITILIIALIALSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFIS TVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPG HPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Database link: Q07108 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175391 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 23 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 23 kDa. |
Target
-
Function
Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. -
Tissue specificity
Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. -
Sequence similarities
Contains 1 C-type lectin domain. -
Developmental stage
Earliest inducible cell surface glycoprotein acquired during lymphoid activation. -
Post-translational
modificationsConstitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 969 Human
- Entrez Gene: 12515 Mouse
- Omim: 107273 Human
- SwissProt: Q07108 Human
- SwissProt: P37217 Mouse
- Unigene: 208854 Human
- Unigene: 74745 Mouse
-
Alternative names
- Activation inducer molecule (AIM/CD69) antibody
- Activation inducer molecule antibody
- AIM antibody
see all
Images
-
All lanes : Anti-CD69 antibody (ab175391) at 1/1000 dilution
Lane 1 : THP-1 cell lysate
Lane 2 : Jurkat cell lysate
Lane 3 : U-251MG cell lysate
Lane 4 : U-937 cell lysate
Lane 5 : Mouse lung tissue lysate
Lane 6 : Mouse thymus tissue lysate
Lane 7 : Mouse spleen tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat AntiRabbit IgG (H+L) at 1/10000 dilution
Developed using the ECL technique.
Predicted band size: 23 kDa
Exposure time: 30 secondsBlocking buffer: 3% nonfat dry milk in TBST.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175391 has been referenced in 1 publication.
- León-Letelier RA et al. Induction of Progenitor Exhausted Tissue-Resident Memory CD8+ T Cells Upon Salmonella Typhi Porins Adjuvant Immunization Correlates With Melanoma Control and Anti-PD-1 Immunotherapy Cooperation. Front Immunol 11:583382 (2020). PubMed: 33240271