Overview

  • Product name
  • Description
    Rabbit polyclonal to CD69
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD69 aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEP G


    Database link: Q07108

  • Positive control
    • Human lung carcinoma tissue. Mouse lung tissue. Mouse lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab202909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 23 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function
    Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
  • Tissue specificity
    Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Developmental stage
    Earliest inducible cell surface glycoprotein acquired during lymphoid activation.
  • Post-translational
    modifications
    Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activation inducer molecule (AIM/CD69) antibody
    • Activation inducer molecule antibody
    • AIM antibody
    • BL-AC/P26 antibody
    • BLAC/P26 antibody
    • C-type lectin domain family 2 member C antibody
    • CD69 antibody
    • CD69 antigen (p60, early T-cell activation antigen) antibody
    • CD69 antigen antibody
    • CD69 molecule antibody
    • CD69_HUMAN antibody
    • CLEC2C antibody
    • EA1 antibody
    • Early activation antigen CD69 antibody
    • Early lymphocyte activation antigen antibody
    • Early T cell activation antigen p60 antibody
    • Early T-cell activation antigen p60 antibody
    • GP32/28 antibody
    • Leu23 antibody
    • Leukocyte surface antigen Leu-23 antibody
    • MLR-3 antibody
    • MLR3 antibody
    • VEA antibody
    • Very Early Activation Antigen antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lung tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-CD69 antibody (ab202909) at 1/200 dilution

    Lane 1 : Mouse intestine or brain lysate
    Lane 2 : Mouse lung lysate

    Predicted band size: 23 kDa

References

This product has been referenced in:
  • Fan X  et al. Overexpression of p53 delivered using recombinant NDV induces apoptosis in glioma cells by regulating the apoptotic signaling pathway. Exp Ther Med 15:4522-4530 (2018). Read more (PubMed: 29731836) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up