Anti-CD69 antibody [MM0688-14F49] (ab201570)

Overview

  • Product name
    Anti-CD69 antibody [MM0688-14F49]
    See all CD69 primary antibodies
  • Description
    Mouse monoclonal [MM0688-14F49] to CD69
  • Host species
    Mouse
  • Tested applications
    Suitable for: ELISA, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD69 aa 64-198.
    Sequence:

    GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNAC SEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNN WFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPY


    Database link: Q07108

Properties

Applications

Our Abpromise guarantee covers the use of ab201570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB 1/500 - 1/1000. Predicted molecular weight: 23 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function
    Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
  • Tissue specificity
    Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Developmental stage
    Earliest inducible cell surface glycoprotein acquired during lymphoid activation.
  • Post-translational
    modifications
    Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activation inducer molecule (AIM/CD69) antibody
    • Activation inducer molecule antibody
    • AIM antibody
    • BL-AC/P26 antibody
    • BLAC/P26 antibody
    • C-type lectin domain family 2 member C antibody
    • CD69 antibody
    • CD69 antigen (p60, early T-cell activation antigen) antibody
    • CD69 antigen antibody
    • CD69 molecule antibody
    • CD69_HUMAN antibody
    • CLEC2C antibody
    • EA1 antibody
    • Early activation antigen CD69 antibody
    • Early lymphocyte activation antigen antibody
    • Early T cell activation antigen p60 antibody
    • Early T-cell activation antigen p60 antibody
    • GP32/28 antibody
    • Leu23 antibody
    • Leukocyte surface antigen Leu-23 antibody
    • MLR-3 antibody
    • MLR3 antibody
    • VEA antibody
    • Very Early Activation Antigen antibody
    see all

References

ab201570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up