Overview

  • Product name
  • Description
    Rabbit polyclonal to CD70
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD70 aa 1-193.
    Sequence:

    MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPL ESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHR DGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQG CTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP


    Database link: P32970

  • Positive control
    • NCI-H460 cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.

Target

  • Function
    Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 27L antibody
    • CD 70 antibody
    • CD27 L antibody
    • CD27 LG antibody
    • CD27 ligand antibody
    • CD27-L antibody
    • CD27L antibody
    • CD27LG antibody
    • CD70 antibody
    • CD70 antigen antibody
    • CD70 molecule antibody
    • CD70_HUMAN antibody
    • Ki 24 antigen antibody
    • Ki24 antigen antibody
    • Surface antigen CD70 antibody
    • TNFSF 7 antibody
    • TNFSF7 antibody
    • Tumor necrosis factor (ligand) superfamily, member 7 antibody
    • Tumor necrosis factor ligand superfamily member 7 antibody
    see all

Images

  • Anti-CD70 antibody (ab175389) at 1/500 dilution + NCI-H460 cell extract

    Predicted band size: 21 kDa

References

ab175389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up