Overview

  • Product name
  • Description
    Rabbit polyclonal to CD83
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CD83 aa 1-205. NCBI: AAH30830.1
    Sequence:

    MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWV KLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSC NSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLA LVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPH KTELV


    Database link: Q01151

  • Positive control
    • CD83 transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function
    May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
  • Tissue specificity
    Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • B cell activation 45kDa cell surface glycoprotein Ig superfamily antibody
    • B cell activation protein antibody
    • B-cell activation protein antibody
    • BL11 antibody
    • BL11 PEN antibody
    • CD83 antibody
    • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) antibody
    • CD83 antigen antibody
    • CD83 molecule antibody
    • CD83_HUMAN antibody
    • Cell surface glycoprotein antibody
    • Cell surface protein HB15 antibody
    • HB15 antibody
    • hCD83 antibody
    see all

Images

  • All lanes : Anti-CD83 antibody (ab172365) at 1 µg/ml

    Lane 1 : CD83 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L)-Peroxidase conjugated at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 23 kDa

References

ab172365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up