Overview

  • Product name
  • Description
    Rabbit Polyclonal to CD84
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human CD84 aa 131-180 (internal sequence).
    Sequence:

    RLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSLGEEGNVLQI


    Database link: Q9UIB8

  • Positive control
    • Extracts of K562 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride

    PBS is without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 39 kDa.

Target

  • Function
    Plays a role as adhesion receptor functioning by homophilic interactions and by clustering. Recruits SH2 domain-containing proteins SH2D1A/SAP. Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seen be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A/SAP-dependent pathway. May serve as a marker for hematopoietic progenitor cells.
  • Tissue specificity
    Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cells.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Developmental stage
    Expression is slightly increased in naive B-cells after the first dividion. By contrast, expression on memory B-cells decreased with each successive division.
  • Domain
    ITSM (immunoreceptor tyrosine-based switch motif) motif is a cytoplasmic motif which may bind SH2D1A.
  • Post-translational
    modifications
    Phosphorylated by tyrosine-protein kinase LCK on tyrosine residues following ligation induced by agonist monoclonal antibody. The association with SH2D1A/SAP is dependent of tyrosines phosphorylation of its cytoplasmic domain Phosphorylated on Tyr-296 and Tyr-316 following platelet aggregation.
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD_antigen=CD84 antibody
    • CD84 antibody
    • CD84 antigen antibody
    • CD84 molecule antibody
    • CDw84 antibody
    • Cell surface antigen MAX.3 antibody
    • hCD84 antibody
    • Hly9 beta antibody
    • Hly9-beta antibody
    • Leucocyte differentiation antigen CD84 antibody
    • Leukocyte Antigen antibody
    • Leukocyte antigen CD84 antibody
    • Leukocyte differentiation antigen antibody
    • Leukocyte differentiation antigen CD84 antibody
    • LY9B antibody
    • mCD84 antibody
    • Signaling lymphocytic activation molecule 5 antibody
    • SLAF5_HUMAN antibody
    • SLAM family member 5 antibody
    • SLAMF5 antibody
    see all

Images

  • Anti-CD84 antibody (ab190639) at 1/500 dilution + extracts of K562 cells at 30 µg

    Predicted band size : 39 kDa

References

ab190639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up