Overview

  • Product name
    Anti-CDC20B antibody
  • Description
    Rabbit polyclonal to CDC20B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CDC20B aa 101-188.
    Sequence:

    EASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMD RDWKESVASKGQKCLKQLFVTQNVVQQANGKMQLCEQS


    Database link: Q86Y33

  • Positive control
    • Human kidney tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities
    Belongs to the WD repeat CDC20/Fizzy family.
    Contains 7 WD repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD20B_HUMAN antibody
    • CDC20 cell division cycle 20 homolog B antibody
    • CDC20 like protein antibody
    • CDC20B antibody
    • CDC20B protein antibody
    • cell division cycle 20 homolog B (S cerevisiae) antibody
    • Cell division cycle protein 20 homolog B antibody
    • G6VTS76519 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human paraffin-embedded Human kidney labeling CDC20B with ab185481 at 1/50 a dilution.

References

ab185481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up