Overview

  • Product name
  • Description
    Rabbit polyclonal to CDK10
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CDK10 aa 1-360.
    Sequence:

    MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTY GIVYRARDTQ TDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNI VELKEVVVGNHLESIFLVMGYC EQDLASLLENMPTPFSEAQVKCIVLQ VLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTA DFGLARAYGVPVKP MTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLP GT SEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWL SEAGLRLL HFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPH HRNKRAAPATSEGQSKRCKP


    Database link: Q15131

Properties

Applications

Our Abpromise guarantee covers the use of ab181752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/1000.
WB 1/200 - 1/2000. Predicted molecular weight: 41 kDa.

Target

  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDC2 related protein kinase antibody
    • Cdk10 antibody
    • CDK10_HUMAN antibody
    • Cell division protein kinase 10 antibody
    • Cyclin dependent kinase 10 antibody
    • Cyclin dependent kinase related protein antibody
    • Cyclin-dependent kinase 10 antibody
    • PISSLRE antibody
    • Serine/threonine protein kinase PISSLRE antibody
    • Serine/threonine-protein kinase PISSLRE antibody
    see all

References

ab181752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up