Overview

  • Product name
  • Description
    Rabbit polyclonal to CDKL5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human CDKL5 aa 65-110.
    Sequence:

    RTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPE


    Database link: O76039

  • Positive control
    • HEK293T, Raw264.7 and PC12 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab191510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 116 kDa.

Target

  • Function
    Mediates phosphorylation of MECP2.
  • Tissue specificity
    Expressed in brain, lung, kidney, prostate, ovary, placenta, pancreas and testis.
  • Involvement in disease
    Note=Chromosomal aberrations involving CDKL5 are found in patients manifesting early-onset seizures and spams and psychomotor impairment. Translocation t(X;6)(p22.3;q14); translocation t(X;7)(p22.3;p15).
    Defects in CDKL5 are a cause of epileptic encephalopathy early infantile type 2 (EIEE2) [MIM:300672]; also known as atypical CDKL5-related Rett syndrome. EIEE2 is a severe form of epilepsy characterized by seizures or spasms beginning in infancy. Patients manifest features resembling Rett syndrome such as microcephaly, lack of speech development, stereotypic hand movements.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cdkl5 antibody
    • CDKL5_HUMAN antibody
    • Cyclin dependent kinase 5 transcript antibody
    • Cyclin-dependent kinase-like 5 antibody
    • EIEE2 antibody
    • ISSX antibody
    • Serine/threonine kinase 9 antibody
    • Serine/threonine-protein kinase 9 antibody
    • Stk9 antibody
    see all

Images

  • All lanes : Anti-CDKL5 antibody (ab191510)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 116 kDa

References

ab191510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up