Overview

  • Product name
    Anti-CDKN2AIPNL antibody (HRP)
    See all CDKN2AIPNL primary antibodies
  • Description
    Rabbit polyclonal to CDKN2AIPNL (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human CDKN2AIPNL aa 1-116.
    Sequence:

    MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPD YRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVED LPQFTTRSELMKKHQS


    Database link: Q96HQ2

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/20 - 1/300. Predicted molecular weight: 13 kDa.

Target

References

ab193152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up