Overview

  • Product name
    Anti-CDKN2A/p16INK4a antibody [1D7D2A1]
    See all CDKN2A/p16INK4a primary antibodies
  • Description
    Mouse monoclonal [1D7D2A1] to CDKN2A/p16INK4a
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human CDKN2A/p16INK4a aa 1-156.
    Sequence:

    MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD


    Database link: P42771

  • Positive control
    • WB: Recombinant human CDKN2A protein; CDKN2A transfected HEK293 cells; HeLa, HepG2, HEK293 cell lysate. Flow Cytometry: HeLa cells. IHC-P: Human endometrial cancer and esophageal cancer tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR286368-6 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab201980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Form
    There are 4 isoforms produced by alternative splicing. Isoform 1 also known as: p16INK4a; Isoform 3 also known as: p12; Isoform 4 also known as: p14ARF; p19ARF; ARF.
  • Alternative names
    • CCM2 antibody
    • CDK4 inhibitor p16 INK4 antibody
    • CDK4I antibody
    • CDKN2 antibody
    • CDKN2A antibody
    • Cell cycle negative regulator beta antibody
    • CMM2 antibody
    • Cyclin dependent kinase 4 inhibitor A antibody
    • Cyclin dependent kinase inhibitor 2A (melanoma p16 inhibits CDK4) antibody
    • Cyclin Dependent Kinase Inhibitor 2A antibody
    • Cyclin dependent kinase inhibitor 2A isoform 4 antibody
    • Cyclin dependent kinase inhibitor 2A isoforms 1/2/3 antibody
    • Cyclin dependent kinase inhibitor p16 antibody
    • INK4 antibody
    • INK4A antibody
    • MLM antibody
    • MTS1 antibody
    • Multiple tumor suppressor 1 antibody
    • p14 antibody
    • p16 antibody
    • P16INK4 antibody
    • p16INK4a antibody
    • p19 antibody
    • p19Arf antibody
    • TP16 antibody
    see all

Images

  • Anti-CDKN2A/p16INK4a antibody [1D7D2A1] (ab201980) at 1/500 dilution + recombinant human CDKN2A protein

    Predicted band size: 17 kDa

  • Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissues labeling CDKN2A using ab201980 at 1/200 dilution followed by DAB staining.

  • Flow cytometric analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cells labeling CDKN2A using ab201980 at 1/200 dilution (green) compared with a negative control (red).

  • All lanes : Anti-CDKN2A/p16INK4a antibody [1D7D2A1] (ab201980) at 1/500 dilution

    Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : CDKN2A (AA: 1-156)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 17 kDa

  • Immunohistochemical analysis of paraffin-embedded human esophageal cancer tissues labeling CDKN2A using ab201980 at 1/200 dilution followed by DAB staining.

  • All lanes : Anti-CDKN2A/p16INK4a antibody [1D7D2A1] (ab201980) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 17 kDa

References

This product has been referenced in:
  • Zhu XX  et al. Jarid2 is essential for the maintenance of tumor initiating cells in bladder cancer. Oncotarget 8:24483-24490 (2017). WB ; Human . Read more (PubMed: 28445934) »
  • Wang C  et al. Krüppel-like factor 2 suppresses human gastric tumorigenesis through inhibiting PTEN/AKT signaling. Oncotarget 8:100358-100370 (2017). Read more (PubMed: 29245984) »

See all 3 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (Ovarian Tumor)
Permeabilization
Yes - PBS+0.3% Triton-X-100
Specification
Ovarian Tumor
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
Fixative
Paraformaldehyde
Username

Dr. Ravikumar Muthuswamy

Verified customer

Submitted May 15 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up