Overview

  • Product name
    Anti-CDKN2A/p16INK4a antibody
    See all CDKN2A/p16INK4a primary antibodies
  • Description
    Rabbit Polyclonal to CDKN2A/p16INK4a
  • Tested applications
    Suitable for: IHC-P, ICC/IF, IP, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CDKN2A/p16INK4a aa 8-156. (NP_000068.1).
    Sequence:

    SMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSA RVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVR DAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD


    Database link: P42771

  • Positive control
    • Human prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab189302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 17 kDa.

Target

  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Form
    There are 4 isoforms produced by alternative splicing. Isoform 1 also known as: p16INK4a; Isoform 3 also known as: p12; Isoform 4 also known as: p14ARF; p19ARF; ARF.
  • Alternative names
    • CCM2 antibody
    • CDK4 inhibitor p16 INK4 antibody
    • CDK4I antibody
    • CDKN2 antibody
    • CDKN2A antibody
    • Cell cycle negative regulator beta antibody
    • CMM2 antibody
    • Cyclin dependent kinase 4 inhibitor A antibody
    • Cyclin dependent kinase inhibitor 2A (melanoma p16 inhibits CDK4) antibody
    • Cyclin Dependent Kinase Inhibitor 2A antibody
    • Cyclin dependent kinase inhibitor 2A isoform 4 antibody
    • Cyclin dependent kinase inhibitor 2A isoforms 1/2/3 antibody
    • Cyclin dependent kinase inhibitor p16 antibody
    • INK4 antibody
    • INK4A antibody
    • MLM antibody
    • MTS1 antibody
    • Multiple tumor suppressor 1 antibody
    • p14 antibody
    • p16 antibody
    • P16INK4 antibody
    • p16INK4a antibody
    • p19 antibody
    • p19Arf antibody
    • TP16 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate tissue labeling CDKN2A with ab189302 at 1/500 dilution, followed by biotinylated secondary antibody, alkaline phosphatase-streptavidin and chromogen.

References

This product has been referenced in:
  • Tao YF  et al. Molecular mechanism of G1 arrest and cellular senescence induced by LEE011, a novel CDK4/CDK6 inhibitor, in leukemia cells. Cancer Cell Int 17:35 (2017). Read more (PubMed: 28286417) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up