Overview

  • Product name
  • Description
    Mouse polyclonal to CENPC
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CENPC aa 1-542.
    Sequence:

    MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLAND FSTNSTKSVPNSTRKIKDTCIQSPSKECQKSHPKSVPVSSKKKEASLQFV VEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRNINDHHSEADE EFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVS VKTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDS EYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIE DEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKH HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKY EMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHIT QDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRF SSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESCLKC


    Database link: AAH30695

  • Positive control
    • CENPC-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 62 kDa.

Target

  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPC recruits DNA methylation and DNMT3B to both centromeric and pericentromeric satellite repeats and regulates the histone code in these regions.
  • Sequence similarities
    Belongs to the CENPC family.
  • Domain
    The MIF2 homology domain II targets centromeres and binds the alpha satellite DNA in vivo. The MIF2 homology domain III can induce CENPC dimerization/oligomerization.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres.
  • Information by UniProt
  • Database links
  • Alternative names
    • CENP-C 1 antibody
    • CENP-C antibody
    • CENPC_HUMAN antibody
    • CENPC1 antibody
    • Centromere autoantigen C antibody
    • Centromere autoantigen C1 antibody
    • Centromere protein C 1 antibody
    • Centromere protein C antibody
    • hcp-4 antibody
    • ICEN7 antibody
    • Interphase centromere complex protein 7 antibody
    • MIF2 antibody
    see all

Images

  • All lanes : Anti-CENPC antibody (ab171774) at 1/500 dilution

    Lane 1 : CENPC-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 62 kDa

References

This product has been referenced in:
  • Xiao T  et al. CTCF Recruits Centromeric Protein CENP-E to the Pericentromeric/Centromeric Regions of Chromosomes through Unusual CTCF-Binding Sites. Cell Rep 12:1704-14 (2015). WB ; Human . Read more (PubMed: 26321640) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up