Anti-CENPI antibody - N-terminal (ab178754)

Overview

  • Product name
    Anti-CENPI antibody - N-terminal
    See all CENPI primary antibodies
  • Description
    Rabbit polyclonal to CENPI - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Dog, Pig
  • Immunogen

    Synthetic peptide within Human CENPI aa 39-88 (N terminal). The exact sequence is proprietary.
    Sequence:

    SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL


    Database link: Q92674-2

  • Positive control
    • Human thyroid tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Relevance
    CENPI is a constitutive protein of the knetochore that shares limited similarity with Mis6 of S. pombe. The kinetochore is a macromolecular complex located at the centromere of chromosomes and provides essential functions for chromosome segregration. CENPI is required for the localization of CENPF and the checkpoint proteins MAD1 and MAD2 to the kinetochore.
  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Alternative names
    • CENP I antibody
    • centromere protein I antibody
    • Follicle simulating hormone primary response protein antibody
    • FSH primary response 1 antibody
    • FSH primary response protein 1 antibody
    • FSH primary response, rat, homolog of, 1 antibody
    • FSHP1 antibody
    • FSHPRH1 antibody
    • interphase centromere complex protein 19 antibody
    • Leucine rich primary response gene 1 antibody
    • Leucine rich primary response protein 1 antibody
    • LRPR1 antibody
    • Mis6 antibody
    see all

Images

  • Anti-CENPI antibody - N-terminal (ab178754) at 1 µg/ml + Human thyroid tumor lysate at 10 µg

    Predicted band size: 60 kDa

References

ab178754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up