Overview

  • Product name
  • Description
    Rabbit polyclonal to Centrin 2
  • Host species
    Rabbit
  • Specificity
    This antibody detects endogenous levels of Centrin 2 protein.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Centrin 2 aa 1-172.
    Sequence:

    MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDV KELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD RDGDGEVSEQEFLRIMKKTSLY


    Database link: P41208

Properties

Applications

Our Abpromise guarantee covers the use of ab192413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 20 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Plays a fundamental role in microtubule-organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CEP110.
    Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with RAD23B appears to stabilize XPC. In vitro, stimulates DNA binding of the XPC:RAD23B dimer.
    The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair.
  • Sequence similarities
    Belongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome > centriole. Nucleus. Centrosome of S-phase, interphase and mitotic cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • 20kD calcium binding protein antibody
    • CALT antibody
    • caltractin antibody
    • Caltractin isoform 1 antibody
    • CEN2 antibody
    • centrin antibody
    • centrin, EF hand protein, 2 antibody
    • Centrin-2 antibody
    • Centrin2 antibody
    • CETN2 antibody
    • CETN2_HUMAN antibody
    • EF hand protein 2 antibody
    • EF-hand protein antibody
    see all

References

ab192413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up