Anti-Ceramide synthase 1 antibody (ab98062)

Overview

  • Product name
    Anti-Ceramide synthase 1 antibody
    See all Ceramide synthase 1 primary antibodies
  • Description
    Rabbit polyclonal to Ceramide synthase 1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 300-349 (

    LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR

    ) of Human LASS1 (NP_067090).

  • Positive control
    • OVCAR-3 call lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.
  • Sequence similarities
    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization
    Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ceramide synthase 1 antibody
    • CerS1 antibody
    • CERS1_HUMAN antibody
    • LAG1 antibody
    • LAG1 homolog ceramide synthase 1 antibody
    • LAG1 longevity assurance homolog 1 antibody
    • LASS 1 antibody
    • LASS1 antibody
    • Longevity assurance (LAG1 S. cerevisiae) homolog 1 antibody
    • Longevity assurance gene 1 antibody
    • Longevity assurance gene 1 protein homolog 1 antibody
    • MGC90349 antibody
    • Protein LAG1 antibody
    • Protein UOG 1 antibody
    • Protein UOG-1 antibody
    • UOG 1 protein antibody
    • UOG1 antibody
    • Upstream of GDF1 antibody
    see all

Images

  • Anti-Ceramide synthase 1 antibody (ab98062) at 1 µg/ml (in 5% skim milk / PBS buffer) + OVCAR-3 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa

References

ab98062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up