Overview

  • Product nameAnti-CES2 antibody
    See all CES2 primary antibodies
  • Description
    Mouse monoclonal to CES2
  • SpecificityThis antibody is raised against an immunogen sequence within the human cocaine esterase isoform 1 protein (NP_003860.2).
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CES2 aa 514-622.
    Sequence:

    PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGN PNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQEL EEPEERHT

Properties

Applications

Our Abpromise guarantee covers the use of ab56528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
IHC-P
  • Application notesWB: Use at a concentration of 1-5 µg/ml.
    IHC-P: Use at a concentration of 3 µg/ml.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionInvolved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methyumbelliferyl acetate, heroin and 6-monoacetylmorphine.
    • Tissue specificityPreferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.
    • Sequence similaritiesBelongs to the type-B carboxylesterase/lipase family.
    • Post-translational
      modifications
      Glycosylated.
    • Cellular localizationEndoplasmic reticulum lumen.
    • Information by UniProt
    • Database links
    • Alternative names
      • Carboxylesterase 2 (intestine, liver) antibody
      • Carboxylesterase 2 antibody
      • CE-2 antibody
      • CES2 antibody
      • CES2A1 antibody
      • Cocaine esterase antibody
      • EC 3.1.1.1 antibody
      • EST2_HUMAN antibody
      • hCE-2 antibody
      • ICE antibody
      • Iintestinal carboxylesterase liver carboxylesterase 2 antibody
      • Intestinal carboxylesterase; liver carboxylesterase-2 antibody
      • Methylumbelliferyl acetate deacetylase 2 antibody
      • PCE 2 antibody
      • PCE-2 antibody
      see all

    Anti-CES2 antibody images

    • CES2 antibody (ab56528) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human colon.


    • Predicted band size : 62 kDa
      CES2 antibody (ab56528) at 1ug/lane + HepG2 cell lysate at 25ug/lane.

    References for Anti-CES2 antibody (ab56528)

    ab56528 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab56528.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"