Overview

  • Product name
    Anti-cetA antibody
  • Description
    Mouse polyclonal to cetA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with Campylobacter jejuni. Not yet tested in ohter species.
  • Immunogen

    Fusion protein:

    SVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDERAQGVINELSS ETELNLAKEFIKDNAKKAIEESSQDYIDQKAYDAIVNDIKSLEQRSAEIL

    , corresponding to amino acids 355/454 of Campylobacter jejuni methyl-accepting chemotaxis protein.

  • General notes
    Produced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Constituents: 50% Glycerol
  • Purity
    Whole antiserum
  • Primary antibody notes
    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 51 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • Relevance
    Bacterial chemotactic-signal transducers are proteins that respond to changes in the concentration of attractants and repellents in the environment, and transduce a signal from the outside to the inside of the cell. These proteins undergo two covalent modifications: deamidation and reversible methylation. Attractants increase the level of methylation while repellents decrease it. The methyl groups are added by the methyl-transferase cheR and are removed by the methylesterase cheB
  • Alternative names
    • methyl-accepting chemotaxis protein antibody

Images

  • All lanes : Anti-cetA antibody (ab22172) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 51 kDa

References

ab22172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab22172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up