Overview

  • Product name
  • Description
    Rabbit polyclonal to CFHR1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human CFHR1 aa 22-330 (C terminal). The exact sequence is proprietary. Genbank No.: BC016755.
    Sequence:

    FCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRIT CTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQ NNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGER VRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITS FPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISRE IMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGK LEYPTCAKR


    Database link: Q03591

  • Positive control
    • WB: Human liver cancer tissue lysate. IHC-P: Human liver cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol

    PBS (without Mg2+and Ca2+)
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/30 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Function
    Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Contains 5 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated. Two forms are observed; one with a single side chain and the other with two.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • CFHL antibody
    • CFHL1 antibody
    • CFHL1P antibody
    • CFHR1 antibody
    • CFHR1P antibody
    • Complement factor H related 1 antibody
    • Complement factor H related 1 pseudogene antibody
    • Complement factor H related protein 1 precursor antibody
    • Complement factor H-related protein 1 antibody
    • FHR 1 antibody
    • FHR-1 antibody
    • FHR1 antibody
    • FHR1_HUMAN antibody
    • H factor (complement) like 1 antibody
    • H factor (complement) like 2 antibody
    • H factor like protein 1 antibody
    • H factor-like protein 1 antibody
    • H-factor-like 1 antibody
    • H36 1 antibody
    • H36 2 antibody
    • H36 antibody
    • HFL1 antibody
    • HFL2 antibody
    • MGC104329 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling CFHR1 with ab182652 at 1/30 dilution. The image on the right is treated with the immunizing protein.

  • Anti-CFHR1 antibody (ab182652) at 1/500 dilution + Human liver cancer tissue lysate at 40 µg

    Secondary
    Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 38 kDa


    Exposure time: 30 seconds


    10% SDS-PAGE.

References

ab182652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up