Anti-CHMP4C antibody - C-terminal (ab174798)

Overview

  • Product name
    Anti-CHMP4C antibody - C-terminal
    See all CHMP4C primary antibodies
  • Description
    Rabbit polyclonal to CHMP4C - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse CHMP4C aa 146-195 (C terminal). The exact sequence is proprietary. Immunogen is taken from within the amino acid 146-195 region.
    Sequence:

    SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA


    Database link: Q9D7F7

  • Positive control
    • Mouse liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab174798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Function
    Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.
  • Tissue specificity
    Expressed in heart, spleen and kidney.
  • Sequence similarities
    Belongs to the SNF7 family.
  • Domain
    The acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components.
  • Cellular localization
    Cytoplasm > cytosol. Late endosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Charged multivesicular body protein 4c antibody
    • CHM4C_HUMAN antibody
    • CHMP4c antibody
    • Chromatin-modifying protein 4c antibody
    • hSnf7-3 antibody
    • hVps32-3 antibody
    • SHAX3 antibody
    • SNF7 homolog associated with Alix 3 antibody
    • SNF7-3 antibody
    • Vacuolar protein sorting-associated protein 32-3 antibody
    • Vps32-3 antibody
    see all

Images

  • Anti-CHMP4C antibody - C-terminal (ab174798) at 1 µg/ml + Mouse liver tissue lysate at 10 µg with Milk at 5 %

    Predicted band size : 26 kDa

References

ab174798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
2 µg
Gel Running Conditions
Reduced Denaturing (4-12% Gel)
Sample
Rat Cell lysate - whole cell (Neurons)
Specification
Neurons
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Aug 22 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up