Anti-Chromodomain helicase DNA binding protein 5 antibody (ab192373)

Overview

  • Product name
    Anti-Chromodomain helicase DNA binding protein 5 antibody
    See all Chromodomain helicase DNA binding protein 5 primary antibodies
  • Description
    Rabbit polyclonal to Chromodomain helicase DNA binding protein 5
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Chromodomain helicase DNA binding protein 5 aa 1367-1412. The exact sequence is proprietary.
    Sequence:

    DNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLL


    Database link: Q8TDI0

  • Positive control
    • HEK293T and NIH-3T3 whole cell lysates. Rat brain tissue lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 223 kDa.

Target

  • Function
    May play a role in the development of the nervous system and the pathogenesis of neural tumors.
  • Tissue specificity
    Preferentially expressed in total brain, fetal brain, and cerebellum. It is also moderately expressed in the adrenal gland.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 2 PHD-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP-dependent helicase CHD5 antibody
    • CHD 5 antibody
    • CHD-5 antibody
    • CHD5 antibody
    • CHD5_HUMAN antibody
    • Chromodomain-helicase-DNA-binding protein 5 antibody
    • DKFZp434N231 antibody
    • KIAA0444 antibody
    • RP1-233K16.2 antibody
    see all

Images

  • All lanes : Anti-Chromodomain helicase DNA binding protein 5 antibody (ab192373) at 1/500 dilution

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : NIH-3T3 whole cell lysate
    Lane 3 : Rat brain tissue lysate


    Predicted band size : 223 kDa

References

ab192373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Zebrafish Cell lysate - nuclear (5-day-old embryos deyolked)
Gel Running Conditions
Reduced Denaturing (8%)
Loading amount
1 µg
Treatment
heat shocked 1 hr 37 C recovery 1 hr rt
Specification
5-day-old embryos deyolked
Blocking step
NAP-Blocker 1x as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 22°C
Username

Abcam user community

Verified customer

Submitted Aug 18 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up