Overview

  • Product name
  • Description
    Rabbit polyclonal to CKAP2L
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CKAP2L aa 608-713.
    Sequence:

    GITSDSLVAETSITSVEELAKKMESVKSCLSPKEREQVTATPRIAKAEQH NYPGIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRYPEMLQEH DLVVAS


    Database link: Q8IYA6

  • Positive control
    • WB: RT-4 and U-251 MG cell lysate. ICC/IF: A431 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 84 kDa.

Target

Images

  • All lanes : Anti-CKAP2L antibody (ab221897) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate


    Predicted band size : 84 kDa
  • A431 cells stained for CKAP2L (green) using ab221897 (4 µg/ml) in ICC/IF. 

References

ab221897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up