Overview

  • Product name
  • Description
    Rabbit polyclonal to CKLF
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 of Human CKLF (

    DNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGF

    ); NP_001035228

  • Positive control
    • Jurkat cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    CKLF is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF protein is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. CKLF may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Cellular localization
    Cell Membrane; Multi-pass membrane protein or Secreted
  • Database links
  • Alternative names
    • C32 antibody
    • Chemokine-like factor antibody
    • chemokine-like factor 1 antibody
    • chemokine-like factor 2 antibody
    • chemokine-like factor 3 antibody
    • chemokine-like factor 4 antibody
    • CKLF1 antibody
    • CKLF2 antibody
    • CKLF3 antibody
    • CKLF4 antibody
    • CKLFSF2 antibody
    • HSPC224 antibody
    • transmembrane proteolipid antibody
    • UCK-1 antibody
    • UCK1 antibody
    see all

Anti-CKLF antibody images

  • Anti-CKLF antibody (ab86264) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 17 kDa
    Observed band size : 11 kDa (why is the actual band size different from the predicted?)
    Additional bands at : >60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-CKLF antibody (ab86264)

ab86264 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up