Overview

  • Product name
  • Description
    Rabbit polyclonal to CKMT2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Chicken, Cow, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human CKMT2 aa 231-280.
    Sequence:

    PVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM


    Database link: P17540

  • Positive control
    • Human heart tissue; NIH 3T3 cells; A549 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function
    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Tissue specificity
    Sarcomere-specific. Found only in heart and skeletal muscles.
  • Sequence similarities
    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CKMT 2 antibody
    • Basic-type mitochondrial creatine kinase antibody
    • CKMT2 antibody
    • CPK antibody
    • Creatine kinase mitochondrial 2 antibody
    • Creatine kinase mitochondrial 2 (sarcomeric) antibody
    • Creatine kinase S-type antibody
    • creatine kinase S-type, mitochondrial antibody
    • Creatine kinase, sarcomeric mitochondrial antibody
    • KCRS_HUMAN antibody
    • Mib CK antibody
    • Mib-CK antibody
    • mitochondrial antibody
    • OTTHUMP00000147542 antibody
    • S-MtCK antibody
    • Sarcomeric mitochondrial creatine kinase antibody
    • SMTCK antibody
    see all

Images

  • All lanes : Anti-CKMT2 antibody (ab189314) at 1/500 dilution

    Lane 1 : A549 cell extract
    Lane 2 : A549 cell extract with synthesized peptide

    Predicted band size: 48 kDa

  • Immunofluorescent analysis of NIH 3T3 cells labeling CKMT2 with ab189314 at 1/100 dilution. The image on the right is treated with the synthesized peptide.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human heart tissue labeling CKMT2 with ab189314 at 10 µg/ml.

References

ab189314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up