Overview

  • Product nameAnti-Clarin-2 antibody
  • Description
    Rabbit polyclonal to Clarin-2
  • Tested applicationsSuitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence:

    VKFHDLTERIANFQEKLFQFVVVEEQYEES

    , corresponding to internal sequence amino acids 159-188 of Human Clarin-2.

  • Positive control
    • Human liver tissue.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab122790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

Anti-Clarin-2 antibody images

  • Immunofluorescent staining of Human cell line U-251 MG shows positivity in cytoplasm and cytoskeleton (intermediate filaments). Recommended concentration of ab122790 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122790, at 1/200 dilution, staining Clarin-2 in paraffin-embedded Human liver tissue by Immunohistochemistry.

References for Anti-Clarin-2 antibody (ab122790)

ab122790 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"