Anti-Claudin 9 antibody [YD4E9] (ab187116)

Overview

  • Product name
    Anti-Claudin 9 antibody [YD4E9]
    See all Claudin 9 primary antibodies
  • Description
    Rat monoclonal [YD4E9] to Claudin 9
  • Tested applications
    Suitable for: Competitive ELISA, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Claudin 9 aa 1-217.
    Sequence:

    MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGL WMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAIT GAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTAHAIIQDFYNP LVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGY SIPSRSGASGLDKRDYV


    Database link: O95484

  • Positive control
    • BOSC23 expressing Claudin 9 cDNA and native Claudin 9 expressed in mammalian cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    YD4E9
  • Isotype
    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Competitive ELISA 1/200 - 1/400.
Flow Cyt Use 1.2µg for 106 cells. ab18536-Rat monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

Target

Images

  • Flow cytometry analysis of BOSC23 cells transiently transfected with an expression vector encoding either Claudin 9 (red curve) or a control transfectant; using ab187116 at 1.2 µg/106 cells. PE-conjugated secondary antibodies were used for the analysis.

References

ab187116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Flow Cytometry
Sample
Human Cell (Human CLDN9 overexpression)
Permeabilization
No
Gating Strategy
Singlets in viable cells
Specification
Human CLDN9 overexpression
Preparation
Cell harvesting/tissue preparation method: Cells deteched with EDTA without trypsin
Sample buffer: 2% FBS in PBS
Fixation
NO Fixation
Username

Abcam user community

Verified customer

Submitted Feb 02 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up