Overview

  • Product nameAnti-CLDN16 antibody
    See all CLDN16 primary antibodies
  • Description
    Rabbit polyclonal to CLDN16
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide (Human) of 14 amino acid residues from the carboxyl terminus region of CLDN16 (FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTET A).

  • Positive control
    • Human fetal lung lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab42482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.6 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

  • FunctionPlays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors.
  • Tissue specificityKidney-specific, including the thick ascending limb of Henle (TAL).
  • Involvement in diseaseDefects in CLDN16 are the cause of hypomagnesemia type 3 (HOMG3) [MIM:248250]; also known as familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC). HOMG3 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis. Recurrent urinary tract infections and kidney stones are often observed. In spite of hypercalciuria, patients do not show hypocalcemia.
  • Sequence similaritiesBelongs to the claudin family.
  • Cellular localizationCell junction > tight junction. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Claudin 16 antibody
    • Claudin-16 antibody
    • CLD16_HUMAN antibody
    • CLDN 16 antibody
    • Cldn16 antibody
    • Paracellin 1 antibody
    • Paracellin-1 antibody
    • PCLN-1 antibody
    • PCLN1 antibody
    see all

Anti-CLDN16 antibody images

  • Anti-CLDN16 antibody (ab42482) at 0.6 µg/ml + Fetal lung lysate at 1 µg

    Secondary
    HRP conjugated goat-anti-Rabbit IgG 1: 50,000 - 100,000

    Predicted band size : 34 kDa
    Observed band size : 34 kDa

References for Anti-CLDN16 antibody (ab42482)

This product has been referenced in:

See all 2 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab42482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"