
  • Product name
  • Description
    Rabbit polyclonal to CLDN16
  • Host species
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide (Human) of 14 amino acid residues from the carboxyl terminus region of CLDN16 (FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTET A).

  • Positive control
    • Human fetal lung lysate.


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab42482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.6 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.


  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors.
  • Tissue specificity
    Kidney-specific, including the thick ascending limb of Henle (TAL).
  • Involvement in disease
    Defects in CLDN16 are the cause of hypomagnesemia type 3 (HOMG3) [MIM:248250]; also known as familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC). HOMG3 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis. Recurrent urinary tract infections and kidney stones are often observed. In spite of hypercalciuria, patients do not show hypocalcemia.
  • Sequence similarities
    Belongs to the claudin family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Claudin 16 antibody
    • Claudin-16 antibody
    • CLD16_HUMAN antibody
    • CLDN 16 antibody
    • Cldn16 antibody
    • Paracellin 1 antibody
    • Paracellin-1 antibody
    • PCLN-1 antibody
    • PCLN1 antibody
    see all


  • Anti-CLDN16 antibody (ab42482) at 0.6 µg/ml + Fetal lung lysate at 1 µg

    HRP conjugated goat-anti-Rabbit IgG 1: 50,000 - 100,000

    Predicted band size: 34 kDa
    Observed band size: 34 kDa


This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab42482.
Please use the links above to contact us or submit feedback about this product.


Sign up