Overview

  • Product name
  • Description
    Rabbit polyclonal to CLEC1B
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (

    MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL

    ) of Mouse CLEC1B (NP_064369).

  • Positive control
    • Mouse pancreas lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab116278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Acts as a receptor for the platelet-aggregating snake venom protein rhodocytin. Rhodocytin binding leads to tyrosine phosphorylation and this promotes the binding of spleen tyrosine kinase (Syk) and initiation of downstream tyrosine phosphorylation events and activation of PLC-gamma-2. Acts as an attachment factor for human immunodeficiency virus type 1 (HIV-1) and facilitates its capture by platelets.
  • Tissue specificity
    Expressed preferentially in the liver. Also expressed in immune cells of myeloid origin and on the surface of platelets.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated on tyrosine residue in response to rhodocytin binding.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1810061I13Rik antibody
    • C type lectin domain family 1 member B antibody
    • C type lectin like receptor 2 antibody
    • C-type lectin domain family 1 member B antibody
    • C-type lectin domain family 1, member B antibody
    • C-type lectin-like receptor 2 antibody
    • C-type lectin-like receptor-2 antibody
    • CLC1B_HUMAN antibody
    • CLEC 2 antibody
    • CLEC 2B antibody
    • CLEC-2 antibody
    • CLEC1B antibody
    • CLEC2 antibody
    • CLEC2B antibody
    • PRO1384 antibody
    • QDED721 antibody
    see all

Images

  • Anti-CLEC1B antibody (ab116278) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 27 kDa

References

ab116278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up