Overview

  • Product name
  • Description
    Mouse polyclonal to CMPK2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human CMPK2 aa 151-250. (NP_997198).
    Sequence:

    GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPL HPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG


    Database link: Q5EBM0

  • Positive control
    • Jurkat cell lysate; recombinant Human CMPK2 protein (immunogen).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab194567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 49 kDa.

Target

  • Function
    May participate in dUTP and dCTP synthesis in mitochondria. Is able to phosphorylate dUMP, dCMP, CMP, UMP and monophosphates of the pyrimidine nucleoside analogs ddC, dFdC, araC, BVDU and FdUrd with ATP as phosphate donor. Efficacy is highest for dUMP followed by dCMP; CMP and UMP are poor substrates. May be involved in mtDNA depletion caused by long term treatment with ddC or other pyrimidine analogs.
  • Tissue specificity
    Among all investigated tumors, leukemia cells show the most abundant expression.
  • Sequence similarities
    Belongs to the thymidylate kinase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1200004E04Rik antibody
    • Cmpk2 antibody
    • CMPK2_HUMAN antibody
    • Cytidine monophosphate (UMP CMP) kinase 2, mitochondrial antibody
    • mitochondrial antibody
    • Mitochondrial UMP CMP kinase antibody
    • OTTHUMP00000200305 antibody
    • Thymidine monophosphate kinase 2 antibody
    • TMPK2 antibody
    • TYKi antibody
    • UMP CMP kinase 2, mitochondrial antibody
    • UMP CMP kinase 2, mitochondrial; cytidylate kinase 2 antibody
    • UMP CMPK2 antibody
    • UMP-CMP kinase 2 antibody
    see all

Images

  • Anti-CMPK2 antibody (ab194567) at 1/500 dilution + Jurkat cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 49 kDa
  • Anti-CMPK2 antibody (ab194567) at 1/1000 dilution + recombinant Human CMPK2 protein (immunogen) at 0.2 µg
    Developed using the ECL technique

    Predicted band size : 49 kDa

    Predicted MWt of immunogen: 37.11 KDa.

References

ab194567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up