Overview

  • Product name
  • Description
    Rabbit polyclonal to CNNM4
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CNNM4 aa 725-775. The exact sequence is proprietary. NCBI Accession No. NP_064569.3.
    Sequence:

    MENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENA I


    Database link: Q6P4Q7-1

  • Positive control
    • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab191207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 87 kDa.

Target

  • Function
    Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions (By similarity). May play a role in biomineralization and retinal function.
  • Tissue specificity
    Widely expressed. Highly expressed in heart.
  • Involvement in disease
    Defects in CNNM4 are the cause of Jalili syndrome (JALIS) [MIM:217080]. A syndrome characterized by the association of cone-rod dystrophy and amelogenesis imperfecta.
  • Sequence similarities
    Belongs to the ACDP family.
    Contains 2 CBS domains.
    Contains 1 DUF21 domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 430430O18Rik antibody
    • ACDP4 antibody
    • Ancient conserved domain protein 4 antibody
    • Ancient conserved domain-containing protein 4 antibody
    • cnnm4 antibody
    • CNNM4_HUMAN antibody
    • Cyclin and CBS domain divalent metal cation transport mediator 4 antibody
    • Cyclin M4 antibody
    • Cyclin-M4 antibody
    • FLJ42791 antibody
    • KIAA1592 antibody
    • Metal transporter CNNM4 antibody
    see all

Images

  • All lanes : Anti-CNNM4 antibody (ab191207) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate prepared using RIPA
    Lane 2 : 293T whole cell lysate prepared using RIPA
    Lane 3 : Jurkat whole cell lysate prepared using RIPA
    Lane 4 : mouse TMCM-1 whole cell lysate prepared using NETN
    Lane 5 : mouse NIH 3T3 whole cell lysate prepared using NETN

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 87 kDa


    Exposure time : 30 seconds
  • Immunoprecipitation analysis of HeLa whole cell lysate prepared using RIPA lysis buffer (1.0 mg per IP reaction; 20% of IP loaded) using ab191207 used at 6 µg per reaction lane 1. Lane 2 shows control IgG. For blotting ab191207 was used at 1 µg/ml. Chemiluminescence with an exposure time of 30 seconds.

References

ab191207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up