
  • Product nameAnti-CNOT2 antibody
    See all CNOT2 primary antibodies
  • Description
    Rabbit polyclonal to CNOT2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 252 - 301 (LAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS N) of Human CNOT2 (NP_055330).

  • Positive control
    • THP-1 cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab90703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-CNOT2 antibody images

  • Anti-CNOT2 antibody (ab90703) at 1 µg/ml + THP-1 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa

References for Anti-CNOT2 antibody (ab90703)

ab90703 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90703.
Please use the links above to contact us or submit feedback about this product.