
  • Product name
  • Description
    Rabbit polyclonal to CNOT6
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (ISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN K) of Human CNOT6, NP_056270

  • Positive control
    • Jurkat cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab86209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Poly(A) nuclease involved in mRNA decay mediated by the major-protein-coding determinant of instability (mCRD) of the FOS gene in the cytoplasm. Has 3'-5' RNase activity. The CCR4-NOT complex functions as general transcription regulation complex.
  • Sequence similarities
    Belongs to the CCR4/nocturin family.
    Contains 4 LRR (leucine-rich) repeats.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • A230103N10Rik antibody
    • AA407540 antibody
    • AW456442 antibody
    • carbon catabolite repression 4 protein antibody
    • Carbon catabolite repressor protein 4 homolog antibody
    • CCR4 antibody
    • CCR4 carbon catabolite repression 4 like antibody
    • CCR4 carbon catabolite repression 4-like antibody
    • CCR4-NOT transcription complex subunit 6 antibody
    • CCR4-NOT transcription complex, subunit 6 antibody
    • Cnot6 antibody
    • CNOT6_HUMAN antibody
    • Cytoplasmic deadenylase antibody
    • EC 3.1.-.- antibody
    • fa03c11 antibody
    • fc17f01 antibody
    • KIAA1194 antibody
    • MGC98472 antibody
    • OTTHUMP00000161544 antibody
    • wu:fa03c11 antibody
    • wu:fc17f01 antibody
    • zgc:65822 antibody
    see all

Anti-CNOT6 antibody images

  • Predicted band size : 63 kDa
    Western blot analysis of Jurkat cell lysate labeling CNOT6 with ab86209 at 1.0µg/ml.

  • Predicted band size : 63 kDa
    Western blot analysis of Human fetal heart tissue lysate labeling CNOT6 with ab86209 at 1.0µg/ml.
  • Anti-CNOT6 antibody (ab86209) at 1 µg/ml + Jurkat cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa
    Observed band size : 63 kDa
    Additional bands at : 50 kDa. We are unsure as to the identity of these extra bands.Gel concentration: 12%

References for Anti-CNOT6 antibody (ab86209)

ab86209 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86209.
Please use the links above to contact us or submit feedback about this product.


Sign up