Overview

  • Product name
  • Description
    Rabbit polyclonal to CNOT6
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (ISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN K) of Human CNOT6, NP_056270

  • Positive control
    • Jurkat cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Poly(A) nuclease involved in mRNA decay mediated by the major-protein-coding determinant of instability (mCRD) of the FOS gene in the cytoplasm. Has 3'-5' RNase activity. The CCR4-NOT complex functions as general transcription regulation complex.
  • Sequence similarities
    Belongs to the CCR4/nocturin family.
    Contains 4 LRR (leucine-rich) repeats.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • A230103N10Rik antibody
    • AA407540 antibody
    • AW456442 antibody
    • carbon catabolite repression 4 protein antibody
    • Carbon catabolite repressor protein 4 homolog antibody
    • CCR4 antibody
    • CCR4 carbon catabolite repression 4 like antibody
    • CCR4 carbon catabolite repression 4-like antibody
    • CCR4-NOT transcription complex subunit 6 antibody
    • CCR4-NOT transcription complex, subunit 6 antibody
    • Cnot6 antibody
    • CNOT6_HUMAN antibody
    • Cytoplasmic deadenylase antibody
    • EC 3.1.-.- antibody
    • fa03c11 antibody
    • fc17f01 antibody
    • KIAA1194 antibody
    • MGC98472 antibody
    • OTTHUMP00000161544 antibody
    • wu:fa03c11 antibody
    • wu:fc17f01 antibody
    • zgc:65822 antibody
    see all

Images



  • Predicted band size : 63 kDa
    Western blot analysis of Jurkat cell lysate labeling CNOT6 with ab86209 at 1.0µg/ml.


  • Predicted band size : 63 kDa
    Western blot analysis of Human fetal heart tissue lysate labeling CNOT6 with ab86209 at 1.0µg/ml.
  • Anti-CNOT6 antibody (ab86209) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa
    Observed band size : 63 kDa
    Additional bands at : 50 kDa. We are unsure as to the identity of these extra bands.Gel concentration: 12%

References

ab86209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up