Overview

  • Product name
  • Description
    Rabbit polyclonal to CNTF
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human CNTF aa 2-200. E. coli-derived.
    Sequence:

    AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLD SADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPT EGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM


    Database link: P26441

  • Positive control
    • Rat brain, Human intestinal cancer and Human lung cancer tissues; Recombinant Human CNTF Protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab190985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 23 kDa.
IHC-P Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-CNTF antibody (ab190985) at 0.5 µg/ml + Recombinant Human CNTF Protein at 0.0005 µg

    Predicted band size: 23 kDa

  • Immunohistochemical analysis of paraffin-embedded Human lung cancer tissue labeling CNTF with ab190985.

  • Immunohistochemical analysis of paraffin-embedded Rat brain tissue labeling CNTF with ab190985.

  • Immunohistochemical analysis of fparaffin-embedded Human intestinal cancer tissue labeling CNTF with ab190985.

References

This product has been referenced in:
  • Nie J  et al. Dendrobium alkaloids prevent Aß25-35-induced neuronal and synaptic loss via promoting neurotrophic factors expression in mice. PeerJ 4:e2739 (2016). Read more (PubMed: 27994964) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up