Anti-Coatomer subunit delta antibody (ab81651)


  • Product nameAnti-Coatomer subunit delta antibody
    See all Coatomer subunit delta primary antibodies
  • Description
    Rabbit polyclonal to Coatomer subunit delta
  • Tested applicationsSuitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal ammino acids 289-338 (RDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKK L) of human Coatomer subunit delta (NP_001646).

  • Positive control
    • HepG2 cell lysate. IF/ICC: HeLa cell line.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab81651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use a concentration of 5 µg/ml.


  • FunctionThe coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the adaptor complexes medium subunit family. Delta-COP subfamily.
    Contains 1 MHD (mu homology) domain.
  • Cellular localizationCytoplasm. Golgi apparatus membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
  • Information by UniProt
  • Database links
  • Alternative names
    • Archain 1 antibody
    • Archain antibody
    • Archain vesicle transport protein 1 antibody
    • Arcn1 antibody
    • Coatomer delta subunit antibody
    • Coatomer protein complex, subunit delta antibody
    • Coatomer protein delta COP antibody
    • Coatomer subunit delta antibody
    • COPD_HUMAN antibody
    • Delta coat protein antibody
    • Delta COP antibody
    • Delta-coat protein antibody
    • Delta-COP antibody
    see all

Anti-Coatomer subunit delta antibody images

  • ab81651 stained HeLa cells. The cells were 100% methanol fixed for 5 minutes at -20°C and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1hour at room temperature to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab81651 at 5µg/ml) overnight at +4°C. The secondary antibody (pseudo-colored green) was Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) preadsorbed (ab150081) used at a 1/1000 dilution for 1hour at room temperature. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1hour at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

  • Anti-Coatomer subunit delta antibody (ab81651) at 1 µg/ml + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 58 kDa
    Observed band size : 58 kDa

References for Anti-Coatomer subunit delta antibody (ab81651)

ab81651 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81651.
Please use the links above to contact us or submit feedback about this product.