Overview

  • Product nameAnti-COBLL1 antibody
    See all COBLL1 primary antibodies
  • Description
    Rabbit polyclonal to COBLL1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 899-948 (

    QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP

    ) of Human COBLL1 (NP_055715).

  • Positive control
    • Human Fetal Stomach Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 132 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe function of COBLL1 is not known but there are five named isoforms produced by alternative splicing.
  • Database links
  • Alternative names
    • COBL like 1 antibody
    • Cordon bleu protein like 1 antibody
    • KIAA0977 antibody

Anti-COBLL1 antibody images

  • Anti-COBLL1 antibody (ab99104) at 1 µg/ml + Human Fetal Stomach Lysate at 10 µg

    Predicted band size : 132 kDa

References for Anti-COBLL1 antibody (ab99104)

ab99104 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"