Overview

  • Product name
  • Description
    Mouse monoclonal to Cofilin
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human Cofilin. AAH11005
    Sequence:

    MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILE EGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLV FIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLA EKLGGSAVISLEGKPL


    Database link: P23528

  • Positive control
    • WB: HeLa, PC-12 and NIH/3T3 cell lysate. IHC-P: Human breast cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab54532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 18 kDa.
IHC-P Use a concentration of 1.5 µg/ml.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
  • Tissue specificity
    Widely distributed in various tissues.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated on Ser-3 in resting cells.
  • Cellular localization
    Nucleus matrix. Cytoplasm > cytoskeleton. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.
  • Information by UniProt
  • Database links
  • Alternative names
    • 18 kDa phosphoprotein antibody
    • CFL 1 antibody
    • CFL antibody
    • CFL1 antibody
    • COF1_HUMAN antibody
    • Cofilin 1 antibody
    • Cofilin 1 non muscle antibody
    • Cofilin antibody
    • Cofilin non muscle isoform antibody
    • Cofilin-1 antibody
    • epididymis secretory protein Li 15 antibody
    • HEL-S-15 antibody
    • non-muscle isoform antibody
    • p18 antibody
    see all

Images

  • Anti-Cofilin antibody (ab54532) at 1 µg + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate at 25 µg

    Predicted band size : 18 kDa
  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Cofilin with ab54532 at 1.5 µg/ml in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Cofilin (green) using ab54532 at 10 µg/ml in ICC/IF.

  • Anti-Cofilin antibody (ab54532) at 1 µg/ml + NIH/3T3 (mouse embryo fibroblast cell line) cell lysate

    Predicted band size : 18 kDa
  • Anti-Cofilin antibody (ab54532) at 1 µg/ml + PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate

    Predicted band size : 18 kDa

References

This product has been referenced in:
  • Ye X  et al. Direct dorsal hippocampal-prelimbic cortex connections strengthen fear memories. Nat Neurosci 20:52-61 (2017). Read more (PubMed: 27869801) »
  • Eshraghi M  et al. Effect of genetic background on the phenotype of the Smn2B/- mouse model of spinal muscular atrophy. Hum Mol Genet N/A:N/A (2016). Read more (PubMed: 27538421) »

See all 12 Publications for this product

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunoprecipitation
Sample
Rat Cell lysate - whole cell (PC12, rat pheochromacytoma)
Total protein in input
1000 µg
Specification
PC12, rat pheochromacytoma
Immuno-precipitation step
Protein G
Username

Abcam user community

Verified customer

Submitted Oct 31 2012

Thank you for your reply. I am very pleased to hear you would like to accept our offer and test ab54532 in IP.

Please place your order for ab54532 with the following discount code. This first order will be invoiced at full price:

...

Read More

Thank you very much for your reply. I am pleased to hear you are interested in the testing discount offer.

I can offer a discount off a future purchase if you buy ab54532 now, test it in IP and submit feedback to us in the form of an Abrevie...

Read More

Thank you for contacting us and for your interest in our products.

As far as we are aware, ab54532 has never been tested in IP. All tested applications covered by our 6 month guarantee are specified on our datasheets, and these are updated a...

Read More

Thank you for taking the time to contact us. I am sorry to hear you have had difficulty obtaining satisfactory results from ab54532. The details you have kindly provided will provide us with vital information for our monitoring of product quality
...

Read More

Merci pour votre appel et votre patience.
Le laboratoire vient de me confirmer que ils n'ont pas fait un "epitope mapping" sur cet anticorps, et donc que l'épitope de cet anticorps n'est pas connue. Effectivement, l'immunogène était toute la proté...

Read More

Thank you for contacting us. I am sorry that this new vial of antibody did not perform as stated on the datasheet. If payment has already been made on the original order and you wish to receive a refund, please ask your purchasing department to contact...

Read More

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement for one vial of ab75510. To check the status of the order please contact our Customer...

Read More

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement for one vial of ab75510. This product is currently out of stock. You should expect to...

Read More

Thank you for your enquiry. I am sorry this vial of ab54532 is giving you trouble. Here is a link to another anti-Cofilin antibody you may be interested in: http://www.abcam.com/Cofilin-antibody-ab29038.html As a reminder, please check the datasheet fo...

Read More

1-10 of 13 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up