Overview

  • Product name
    Anti-COG3 antibody - C-terminal
    See all COG3 primary antibodies
  • Description
    Rabbit polyclonal to COG3 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human COG3 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    EGTPEIREHYLDSKKDVDRHLKSACEQFIQQ


    Database link: Q96JB2

  • Positive control
    • HeLa cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99.91% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab170356 is purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 94 kDa.

Target

  • Function
    Involved in ER-Golgi transport.
  • Tissue specificity
    Widely expressed with highest levels in pancreas and testis and lowest levels in lung.
  • Sequence similarities
    Belongs to the COG3 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Associated with the peripheral membrane of cis/medial cisternae.
  • Information by UniProt
  • Database links
  • Alternative names
    • COG complex subunit 3 antibody
    • Cog3 antibody
    • COG3_HUMAN antibody
    • Component of golgi transport complex 3 antibody
    • Component of oligomeric Golgi complex 3 antibody
    • Conserved oligomeric Golgi complex subunit 3 antibody
    • OTTHUMP00000018352 antibody
    • p94 antibody
    • SEC34 antibody
    • SEC34 S. cerevisiae homolog of antibody
    • SEC34, S. cerevisiae, homolog of antibody
    • Tethering factor SEC34 antibody
    • Vesicle docking protein SEC34 homolog antibody
    • Vesicle-docking protein SEC34 homolog antibody
    see all

Images

  • Anti-COG3 antibody - C-terminal (ab170356) at 1/100 dilution + HeLa cell lysate at 35 µg

    Predicted band size: 94 kDa

References

ab170356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up