Overview

  • Product name
    Anti-COG3 antibody - N-terminal
    See all COG3 primary antibodies
  • Description
    Rabbit polyclonal to COG3 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig, Chimpanzee, Rhesus monkey, Gorilla, Common marmoset
  • Immunogen

    Synthetic peptide within Human COG3 aa 1-50 (N terminal). The exact sequence is proprietary. (EAX08741.1).
    Sequence:

    MAEAALLLLPEAAAERDAREKLALWDRRPDTTAPLTDRQTDSVLELKAAA


    Database link: Q96JB2

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab194960 was affinity purified using an epitope specific to COG3 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 94 kDa.

Target

  • Function
    Involved in ER-Golgi transport.
  • Tissue specificity
    Widely expressed with highest levels in pancreas and testis and lowest levels in lung.
  • Sequence similarities
    Belongs to the COG3 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Associated with the peripheral membrane of cis/medial cisternae.
  • Information by UniProt
  • Database links
  • Alternative names
    • COG complex subunit 3 antibody
    • Cog3 antibody
    • COG3_HUMAN antibody
    • Component of golgi transport complex 3 antibody
    • Component of oligomeric Golgi complex 3 antibody
    • Conserved oligomeric Golgi complex subunit 3 antibody
    • OTTHUMP00000018352 antibody
    • p94 antibody
    • SEC34 antibody
    • SEC34 S. cerevisiae homolog of antibody
    • SEC34, S. cerevisiae, homolog of antibody
    • Tethering factor SEC34 antibody
    • Vesicle docking protein SEC34 homolog antibody
    • Vesicle-docking protein SEC34 homolog antibody
    see all

Images

  • All lanes : Anti-COG3 antibody - N-terminal (ab194960) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 94 kDa


    Exposure time: 30 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of COG3 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab194960 at 6 µg/mg lysate for IP and at 0.1 µg/ml for subsequent Western blot detection.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up