Anti-Collagen alpha-1(XXVIII) chain antibody - C-terminal (ab188533)

Overview

  • Product name
    Anti-Collagen alpha-1(XXVIII) chain antibody - C-terminal
  • Description
    Rabbit polyclonal to Collagen alpha-1(XXVIII) chain - C-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Collagen alpha-1(XXVIII) chain aa 1020-1121 (C terminal).
    Sequence:

    SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAED PRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQ ET


    Database link: Q2UY09

  • Positive control
    • Kidney, pancres and skin cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May act as a cell-binding protein.
  • Sequence similarities
    Belongs to the VWA-containing collagen family.
    Contains 1 BPTI/Kunitz inhibitor domain.
    Contains 6 collagen-like domains.
    Contains 2 VWFA domains.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • COL28 antibody
    • Col28a1 antibody
    • Collagen alpha-1(XXVIII) chain antibody
    • Collagen, type XXVIII alpha 1 antibody
    • COSA1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling Collagen alpha-1(XXVIII) chain with ab188533 antibody at a dilution of 1/1000.

  • Immunohistochemical analysis of paraffin embedded Human pancreas tissue labeling Collagen alpha-1(XXVIII) chain with ab188533 antibody at a dilution of 1/1000.

  • Immunohistochemical analysis of paraffin embedded Human skin cancer tissue labeling Collagen alpha-1(XXVIII) chain with ab188533 antibody at a dilution of 1/1000.

References

ab188533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up