Overview

  • Product name
    Anti-Complement C7 antibody
  • Description
    Rabbit polyclonal to Complement C7
  • Specificity
    ab192346 detects endogenous levels of Complement C7 protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Complement C7 aa 1-843.
    Sequence:

    MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRR SVAVYGQYGG QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCIS KSLVCNGDSDCDEDSADEDRCE DSERRPSCDIDKPPPNIELTGNGYNE LTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS GNVLSYTFQVKINN DFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN EI HKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAY RRLIDQYG THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSS GWHFVVKFSSHGCKELENAL KAASGTQNNVLRGEPFIRGGGAGFISGL SYLELDNPAGNKRRYSAWAESVTNLPQVIKQK LTPLYELVKEVPCASV KKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY TFGA ACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRS CVGETT ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFV QDEGTMFPVGKNVVYTCN EGYSLIGNPVARCGEDLRWLVGEMHCQKIA CVLPVLMDGIQSHPQKPFYTVGEKVTVSCS GGMSLEGPSAFLCGSSLK WSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE CGPSLD VCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGAC PLWG KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALR CRGQSISVTSIRPCAA ETQ


    Database link: P10643

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 94 kDa.

Target

  • Function
    Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor.
  • Involvement in disease
    Defects in C7 are a cause of complement component 7 deficiency (C7D) [MIM:610102]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similarities
    Belongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 2 Sushi (CCP/SCR) domains.
    Contains 2 TSP type-1 domains.
  • Post-translational
    modifications
    C7 has 28 disulfide bridges.
    O- and C-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • C7 antibody
    • CO7_HUMAN antibody
    • Complement component C7 antibody

References

ab192346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up