Overview

  • Product nameAnti-Connexin 59/GJA10 antibody
  • Description
    Rabbit polyclonal to Connexin 59/GJA10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    A synthetic peptide corresponding to a region within amino acids 396 - 445 (DGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK G) of Human Connexin 59/GJA10 (NP_110399)

  • Positive control
    • Fetal brain lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionOne gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificityHighly abundant in skeletal muscle. Also detected in testis.
  • Sequence similaritiesBelongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localizationCell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links
  • Alternative names
    • Connexin 58 antibody
    • Connexin 59 antibody
    • Connexin-58 antibody
    • Connexin-59 antibody
    • Cx58 antibody
    • Cx59 antibody
    • CXA9_HUMAN antibody
    • Gap junction alpha 10 protein antibody
    • Gap junction alpha 9 protein antibody
    • Gap junction alpha-10 protein antibody
    • Gap junction alpha-9 protein antibody
    • GJA9 antibody
    • MGC50985 antibody
    see all

Anti-Connexin 59/GJA10 antibody images

  • Anti-Connexin 59/GJA10 antibody (ab86414) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 59 kDa

References for Anti-Connexin 59/GJA10 antibody (ab86414)

ab86414 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"