Overview

  • Product name
    Anti-COPRS antibody
  • Description
    Rabbit polyclonal to COPRS
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human COPRS aa 33-106.
    Sequence:

    EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAM DEEDSDGELNTWELSEGTNCPPKE


    Database link: Q9NQ92

  • Positive control
    • Human liver tissue lysate; Human cell line MCF-7; Human lymph node tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 20 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function
    Histone-binding protein required for histone H4 methyltransferase activity of PRMT5. Specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate specificity of PRMT5. Specifically interacts with the N-terminus of histone H4 but not with histone H3, suggesting that it acts by promoting the association between histone H4 and PRMT5. Involved in CCNE1 promoter repression. Plays a role in muscle cell differentiation by modulating the recruitment of PRMT5 to the promoter of genes involved in the coordination between cell cycle exit and muscle differentiation.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • C17orf79 antibody
    • Cooperator of PRMT5 antibody
    • Coordinator of PRMT5 and differentiation stimulator antibody
    • COPR5 antibody
    • Coprs antibody
    • COPRS_HUMAN antibody
    • HSA272196 antibody
    • Protein TTP1 antibody
    • TTP1 antibody
    see all

Images

  • All lanes : Anti-COPRS antibody (ab185467) at 1/250 dilution

    Lane 1 : Human RT-4 lysate
    Lane 2 : Human U-251MG lysate
    Lane 3 : Human plasma (IgG/HSA depleted) lysate
    Lane 4 : Human liver tissue lysate


    Predicted band size : 20 kDa
  • Immunofluorescent analysis of PFA/Triton X-100 fixed Human cell line MCF-7, labeling COPRS with ab185467 at 4µg/ml. 

  • Immunohistochemical staining of formalin fixed paraffin-embedded Human lymph node tissue labeling COPRS with ab185467 at 1/200 dilution. 

References

ab185467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up