Overview

  • Product name
  • Description
    Rabbit polyclonal to COPS3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chicken, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human COPS3 aa 194-423.
    Sequence:

    GLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPK YTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMG LVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIE DGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAM DQEITVNPQFVQKSMGSQEDDSGNKPSSYS


    Database link: Q9UNS2-1

  • Positive control
    • WB: MCF7, HeLa, HEK-293T and HT-29 whole cell lysates; Mouse heart, brain and ovarian lysates. IHC-P: Human testis and heart tissues. IP: HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab229807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa).
IP 1/200 - 1/2000.

Target

  • Function
    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Tissue specificity
    Widely expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the CSN3 family.
    Contains 1 PCI domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
    see all
  • Alternative names
    • Constitutive photomorphogenic homolog subunit 3 antibody
    • COP 9 (constitutive photomorphogenic) subunit 3 antibody
    • COP 9 complex homolog subunit 3 antibody
    • COP 9 complex S3 antibody
    • COP 9 complex subunit 3 antibody
    • COP 9 constitutive photomorphogenic homolog subunit 3 antibody
    • COP 9 homolog antibody
    • COP 9 signalosome complex subunit 3 antibody
    • COP 9 signalosome subunit 3 antibody
    • COP 9 subunit 3 antibody
    • COP9 (constitutive photomorphogenic) subunit 3 antibody
    • COP9 complex homolog subunit 3 antibody
    • COP9 complex S3 antibody
    • COP9 complex subunit 3 antibody
    • COP9 constitutive photomorphogenic homolog subunit 3 antibody
    • COP9 homolog antibody
    • COP9 signalosome complex subunit 3 antibody
    • COP9 signalosome subunit 3 antibody
    • COP9 subunit 3 antibody
    • COPS 3 antibody
    • cops3 antibody
    • CSN 3 antibody
    • CSN3 antibody
    • CSN3_HUMAN antibody
    • JAB 1 containing signalosome subunit 3 antibody
    • JAB1 containing signalosome subunit 3 antibody
    • JAB1-containing signalosome subunit 3 antibody
    • SGN 3 antibody
    • SGN3 antibody
    • Signalosome subunit 3 antibody
    see all

Images

  • All lanes : Anti-COPS3 antibody (ab229807) at 1/1000 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 4 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate
    Lane 5 : Mouse heart lysate
    Lane 6 : Mouse brain lysate
    Lane 7 : Mouse ovarian lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 48 kDa
    Observed band size: 45 kDa (why is the actual band size different from the predicted?)

  • Paraffin-embedded human testis tissue stained for COPS3 using ab229807 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for COPS3 using ab229807 at 1/100 dilution in immunohistochemical analysis.

  • COPS3 was immunoprecipitated from 500 µg HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate with 4 µg ab229807. 

    Lane 1: Rabbit monoclonal IgG IP in HeLa whole cell lysate.

    Lane 2: ab229807 IP in HeLa whole cell lysate.

    Lane 3: HeLa whole cell lysate 20 µg.

    For western blotting, an HRP-conjugated anti-rabbit IgG,specific to the non-reduced form of IgG was used as the secondary antibody at 1/50000 dilution.

References

ab229807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up