Overview

  • Product nameAnti-Cortactin antibody
    See all Cortactin primary antibodies
  • Description
    Rabbit polyclonal to Cortactin
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 109-158

    KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

    , of Human Cortactin (NP_005222).

  • Positive control
    • Fetal Brain Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 62 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:1562500.

Target

Anti-Cortactin antibody images

  • Anti-Cortactin antibody (ab81508) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal Brain Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 62 kDa
    Observed band size : 62 kDa

References for Anti-Cortactin antibody (ab81508)

ab81508 has not yet been referenced specifically in any publications.

Product Wall

Application Immunocytochemistry/ Immunofluorescence
Blocking step BSA as blocking agent for 20 minute(s) · Concentration: 0.3% · Temperature: 23°C
Sample Fruit fly (Drosophila melanogaster) Cell (wing imaginal disc)
Specification wing imaginal disc
Permeabilization Yes - Triton
Fixative Formaldehyde
Username

Najate Benhra

Verified customer

Submitted Sep 16 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"