• Product nameAnti-CPN1 antibody
    See all CPN1 primary antibodies
  • Description
    Rabbit polyclonal to CPN1
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal amino acids 252-301 (QKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT N) of Human CPN1 (NP_001299).

  • Positive control
    • Transfected 293T cell lysate.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab86556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2.5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionProtects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation.
  • Tissue specificitySynthesized in the liver and secreted in plasma.
  • Involvement in diseaseDefects in CPN1 are the cause of carboxypeptidase N deficiency (CPND) [MIM:212070]. Patients affected present some combination of angioedema or chronic urticaria, as well as hay fever or astma, and have also slightly depressed serum carboxy peptidase N, suggestive of autosomal recessive inheritance of this disorder.
  • Sequence similaritiesBelongs to the peptidase M14 family.
  • Cellular localizationSecreted > extracellular space.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACBP antibody
    • Anaphylatoxin inactivator antibody
    • Arginine carboxypeptidase antibody
    • Carboxypeptidase N catalytic chain antibody
    • Carboxypeptidase N polypeptide 1 50 kD antibody
    • Carboxypeptidase N polypeptide 1 antibody
    • Carboxypeptidase N small subunit antibody
    • CBPN_HUMAN antibody
    • CPN antibody
    • CPN1 antibody
    • Kininase 1 antibody
    • Kininase-1 antibody
    • Kininase1 antibody
    • Lysine carboxypeptidase antibody
    • Plasma carboxypeptidase B antibody
    • SCPN antibody
    • Serum carboxypeptidase N antibody
    see all

Anti-CPN1 antibody images

  • Anti-CPN1 antibody (ab86556) at 1 µg/ml (in 5% skim milk / PBS buffer) + transfected 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    12% gel
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human heart tissue labelling CPN1 with ab86556 at 2.5µg/ml.

References for Anti-CPN1 antibody (ab86556)

This product has been referenced in:
  • Acosta-Martin AE  et al. Quantitative mass spectrometry analysis using PAcIFIC for the identification of plasma diagnostic biomarkers for abdominal aortic aneurysm. PLoS One 6:e28698 (2011). WB ; Human . Read more (PubMed: 22163325) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab86556.
Please use the links above to contact us or submit feedback about this product.