Overview

  • Product nameAnti-CPSF30 antibody
    See all CPSF30 primary antibodies
  • Description
    Mouse polyclonal to CPSF30
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
  • Immunogen

    Fusion protein:

    ITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMT KMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQ

    , corresponding to amino acids 44/143 of Drosophila melanogaster CPSF30.

  • General notes

    Produced from outbred CD1 mice

     

    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 33 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionComponent of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
  • Sequence similaritiesBelongs to the CPSF4/YTH1 family.
    Contains 5 C3H1-type zinc fingers.
    Contains 1 CCHC-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Alternative names
    • cleavage and polyadenylation specific factor 4, 30kDa antibody
    • Cleavage and polyadenylation specificity factor 30 kDa subunit antibody
    • Cleavage and polyadenylation specificity factor subunit 4 antibody
    • cleavage polyadenylation specificity factor, 30kD antibody
    • CPSF 30 kDa subunit antibody
    • CPSF30 antibody
    • Cpsf4 antibody
    • CPSF4_HUMAN antibody
    • NAR antibody
    • Neb-1 antibody
    • NEB1 antibody
    • No arches homolog antibody
    • no arches like zinc finger protein antibody
    • NS1 effector domain binding protein 1 antibody
    • NS1 effector domain-binding protein 1 antibody
    • OTTHUMP00000206235 antibody
    • OTTHUMP00000206237 antibody
    • OTTHUMP00000206239 antibody
    see all

Anti-CPSF30 antibody images

  • All lanes : Anti-CPSF30 antibody (ab21865) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 33 kDa

References for Anti-CPSF30 antibody (ab21865)

ab21865 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. You may be interested in our flyer regarding Drosophila antibodies:

http://docs.abcam.com/pdf/general/Drosophila_Melanogaster_Antibodies_with_cross_activity.pdf

DISCOUNT CODE: ***
Expiration date: Ju...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"