Anti-CRAT antibody - BSA and Azide free (Biotin) (ab182884)

Overview

  • Product name
    Anti-CRAT antibody - BSA and Azide free (Biotin)
    See all CRAT primary antibodies
  • Description
    Rabbit polyclonal to CRAT - BSA and Azide free (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: ICC, WB, Dot blot, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Pigeon
  • Immunogen

    Full length native protein (purified) corresponding to CRAT aa 1-627. Isolated and purified from pigeon breast muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure.
    Sequence:

    MDRKQKQAEKARPYGLLKPAALGKIPGRFQLHQEALPHLPVPPLQQTLDR YLLALQPIISEEELNHTQELVAEFRKPGGVGERLQKGLERRAKKTDNWLS DWWLKTAYLEYRLPVVVHSSPGVVLPKQDFQDRQGQLRFAAKLIEGILDF KTMIDNETLPVEYMGGKPLCMNQYYQILSSCRIPGPKRDSIVNYAKGKKQ SRHITVVHNFQFFELDVYNSDGSPLTTDQLFIQLEKIWNTSLQTNKEPVG ILTTNHRNSWAKAYNNLLKDKTNKESVRTIEKSICTICLDAPMPRVSDDI YKSPVAAQMLHGGGSRWNSGNRWFDKTLQFIIAEDGSCGLVYEHAPAE GPPIVALLDHIVEYTKKPELVRSPMIPLPMPKKLRFNITPEIKSDIEKAK QNLNIMVEDLDVIVLVFHQFGKNYPKSEKISPDAFIQLALQLAYYRMYGH SCATYESASLRMFRLGRTDTIRSTSIESHKFVQSMDSPDKSDQEKADLLR RATQAHKEYTNMAIQGNAIDRHLLGLKLQAIEDLVSIPELFMDTAYAVAM HFNLSTSQVPAKTDCVMCFGPVVPDGYGICYNPMGEHINFAISAFNSCAD TNAARMAHYLEKALLDMRSLLQSAPKSKL


    Database link: P52826

  • General notes

    If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance of the product.

Properties

Applications

Our Abpromise guarantee covers the use of ab182884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC 1/1000 - 1/30000.
WB 1/1000 - 1/30000. Predicted molecular weight: 71 kDa.
Dot blot 1/1000 - 1/30000.
IHC-P 1/1000 - 1/30000.
ELISA 1/1000 - 1/30000.

Target

  • Function
    Carnitine acetylase is specific for short chain fatty acids. Carnitine acetylase seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria.
  • Tissue specificity
    Mostly in skeletal muscle, less in heart, liver and pancreas, only weakly detectable in brain, placenta, lung and kidney.
  • Sequence similarities
    Belongs to the carnitine/choline acetyltransferase family.
  • Cellular localization
    Mitochondrion; Peroxisome and Endoplasmic reticulum. Peroxisome. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CACP_HUMAN antibody
    • Carnitine acetylase antibody
    • Carnitine acetyltransferase antibody
    • Carnitine O acetyltransferase antibody
    • Carnitine O-acetyltransferase antibody
    • CAT antibody
    • CAT1 antibody
    • CrAT antibody
    see all

References

ab182884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up